PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC7999_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family G2-like
Protein Properties Length: 385aa    MW: 43206.6 Da    PI: 8.5358
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC7999_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.93.9e-32211264255
     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  RrC7999_p1 211 PRMRWTSSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 264
                 9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.15E-15208264IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-28209264IPR009057Homeodomain-like
TIGRFAMsTIGR015578.6E-24211264IPR006447Myb domain, plants
PfamPF002495.4E-7212263IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MSMDGVFLEK PKSNTTTTLP DLSLNISLPD THHNESSKEL SRRSSQTDNN RLSNFELSLS  60
HHNNPSSNPS TRILHFPDRR NLYSNHILHG GSLHQRVDES EINNIHRPIR GIPVYHNRSF  120
PFHQQASPSS SLPSLGGDFS ILNSSSGYNN AYRSLQSSPR LKGVPVHHHN HYGVVGSSDS  180
SYPHHHNHHH HGMVRSRFLP KMPTKRSMRA PRMRWTSSLH ARFVHAVELL GGHERATPKS  240
VLELMDVKDL TLAHVKSHLQ MYRTVKTTNK PAASSDGSGE EEMGIDGNER AQSDDTSPHQ  300
EIDFPPTQPR WSNSSGETWP LSNNCASDID TVIRTSSTSM ISHHQRSSLQ NQDQGANDQG  360
KRCGDLSCNN PSLEFTLGRP DWHEK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0301920.0AY030192.1 Arabidopsis thaliana clone A1-2 KANADI protein (KAN) mRNA, complete cds.
GenBankAY0486880.0AY048688.1 Arabidopsis thaliana GARP-like putative transcription factor KANADI1 (KAN1) mRNA, complete cds.
GenBankBT0264360.0BT026436.1 Arabidopsis thaliana At5g16560 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013629405.10.0PREDICTED: transcription repressor KAN1-like
SwissprotQ93WJ90.0KAN1_ARATH; Transcription repressor KAN1
TrEMBLA0A078C1650.0A0A078C165_BRANA; BnaC03g07850D protein
STRINGAT5G16560.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM66062645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.10.0G2-like family protein